PNC-27 10 mg

PNC-27 is a synthetic chimeric peptide built from 32 amino acids. It pairs a fragment of the p53 protein with a small penetratin cell-entry tag, and it is best known in research for its role in studying the p53 signaling pathway.

It also carries a research base, with work exploring how its design interacts with cellular stress pathways in lab models (Sarafraz-Yazdi et al., 2022, Biomedicines). That makes it a useful reference peptide for this kind of investigative work.

Research Applications

• p53 signaling pathway research
• Cellular stress lab models
• Cell-penetrating peptide studies
• Research-model cell biology

Supplied as a lyophilized powder for stability.

See also: FOXO4-DRI, Adipotide (FTPP), and Epitalon.

$21

PNC-27 Structure

Peptide Class: Synthetic chimeric p53-penetratin research peptide
Amino Acid Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Residue Count: 32 amino acids
Key Domains: p53 residues 12-26 (MDM2/HDM-2-binding region) fused to antennapedia penetratin cellular-penetration domain
Molecular Formula: C₁₈₈H₂₉₃N₅₃O₄₄S
Molecular Weight: ~4031.7 g/mol
CAS Number: 1159861-00-3

$22

$23